AMPH monoclonal antibody (M01A), clone 1H3-1D11, Clone: [1H3-1D11], Mouse, Monoclonal

Artikelnummer: ABN-H00000273-M01A
Artikelname: AMPH monoclonal antibody (M01A), clone 1H3-1D11, Clone: [1H3-1D11], Mouse, Monoclonal
Artikelnummer: ABN-H00000273-M01A
Hersteller Artikelnummer: H00000273-M01A
Alternativnummer: ABN-H00000273-M01A-200
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: AMPH (AAH34376.1, 1 a.a. ~ 695 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full length recombinant AMPH.
Klonalität: Monoclonal
Klon-Bezeichnung: [1H3-1D11]
UniProt: 273
Puffer: In ascites fluid
Sequenz: MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFTIQGAPSDSGPL
Target-Kategorie: AMPH