APOA1 monoclonal antibody (M01A), clone 3A11-1A9, Clone: [3A11-1A9], Mouse, Monoclonal

Artikelnummer: ABN-H00000335-M01A
Artikelname: APOA1 monoclonal antibody (M01A), clone 3A11-1A9, Clone: [3A11-1A9], Mouse, Monoclonal
Artikelnummer: ABN-H00000335-M01A
Hersteller Artikelnummer: H00000335-M01A
Alternativnummer: ABN-H00000335-M01A-200
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: APOA1 (AAH05380, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full-length recombinant APOA1.
Klonalität: Monoclonal
Klon-Bezeichnung: [3A11-1A9]
UniProt: 335
Puffer: In ascites fluid
Sequenz: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLS
Target-Kategorie: APOA1