APOA2 monoclonal antibody (M01), clone 4F3, Clone: [4F3], Mouse, Monoclonal

Artikelnummer: ABN-H00000336-M01
Artikelname: APOA2 monoclonal antibody (M01), clone 4F3, Clone: [4F3], Mouse, Monoclonal
Artikelnummer: ABN-H00000336-M01
Hersteller Artikelnummer: H00000336-M01
Alternativnummer: ABN-H00000336-M01-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: APOA2 (AAH05282, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full length recombinant APOA2.
Klonalität: Monoclonal
Klon-Bezeichnung: [4F3]
UniProt: 336
Puffer: In 1x PBS, pH 7.4
Sequenz: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Target-Kategorie: APOA2