BMP7 monoclonal antibody (M15), clone 1F10, Clone: [1F10], Mouse, Monoclonal
Artikelnummer:
ABN-H00000655-M15
| Artikelname: |
BMP7 monoclonal antibody (M15), clone 1F10, Clone: [1F10], Mouse, Monoclonal |
| Artikelnummer: |
ABN-H00000655-M15 |
| Hersteller Artikelnummer: |
H00000655-M15 |
| Alternativnummer: |
ABN-H00000655-M15-100 |
| Hersteller: |
Abnova |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
ELISA |
| Spezies Reaktivität: |
Human |
| Immunogen: |
BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Alternative Synonym: |
ABN-202409-10_Ab |
| Mouse monoclonal antibody raised against a full length recombinant BMP7. |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[1F10] |
| UniProt: |
655 |
| Puffer: |
In 1x PBS, pH 7.4 |
| Sequenz: |
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET |
| Target-Kategorie: |
BMP7 |