BMP7 monoclonal antibody (M17), clone 1E10, Clone: [1E10], Mouse, Monoclonal

Artikelnummer: ABN-H00000655-M17
Artikelname: BMP7 monoclonal antibody (M17), clone 1E10, Clone: [1E10], Mouse, Monoclonal
Artikelnummer: ABN-H00000655-M17
Hersteller Artikelnummer: H00000655-M17
Alternativnummer: ABN-H00000655-M17-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full length recombinant BMP7.
Klonalität: Monoclonal
Klon-Bezeichnung: [1E10]
UniProt: 655
Puffer: In 1x PBS, pH 7.4
Sequenz: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET
Target-Kategorie: BMP7