BNIP3L monoclonal antibody (M02), clone 2E11, Clone: [2E11], Mouse, Monoclonal

Artikelnummer: ABN-H00000665-M02
Artikelname: BNIP3L monoclonal antibody (M02), clone 2E11, Clone: [2E11], Mouse, Monoclonal
Artikelnummer: ABN-H00000665-M02
Hersteller Artikelnummer: H00000665-M02
Alternativnummer: ABN-H00000665-M02-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IP, WB
Spezies Reaktivität: Human
Immunogen: BNIP3L (NP_004322, 43 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a partial recombinant BNIP3L.
Klonalität: Monoclonal
Klon-Bezeichnung: [2E11]
UniProt: 665
Puffer: In 1x PBS, pH 7.4
Sequenz: SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
Target-Kategorie: BNIP3L