RUNX2 monoclonal antibody (MA01), clone 1D8 (APC), IgG2b, Clone: [1D8], Mouse, Monoclonal

Artikelnummer: ABN-H00000860-MA01
Artikelname: RUNX2 monoclonal antibody (MA01), clone 1D8 (APC), IgG2b, Clone: [1D8], Mouse, Monoclonal
Artikelnummer: ABN-H00000860-MA01
Hersteller Artikelnummer: H00000860-MA01
Alternativnummer: ABN-H00000860-MA01-50,ABN-H00000860-MA01-3
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: FC, IF, WB
Spezies Reaktivität: Human
Immunogen: RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Konjugation: APC
APC conjugated mouse monoclonal antibody raised against a partial recombinant RUNX2.
Klonalität: Monoclonal
Klon-Bezeichnung: [1D8]
Isotyp: IgG2b
UniProt: 860
Puffer: In 1x PBS, pH 7.4
Formulierung: Liquid
Sequenz: NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Target-Kategorie: RUNX2