RUNX2 monoclonal antibody (MP01), clone 1D8 (PE), IgG2b, Clone: [1D8], Mouse, Monoclonal
Artikelnummer:
ABN-H00000860-MP01
| Artikelname: |
RUNX2 monoclonal antibody (MP01), clone 1D8 (PE), IgG2b, Clone: [1D8], Mouse, Monoclonal |
| Artikelnummer: |
ABN-H00000860-MP01 |
| Hersteller Artikelnummer: |
H00000860-MP01 |
| Alternativnummer: |
ABN-H00000860-MP01-50,ABN-H00000860-MP01-3 |
| Hersteller: |
Abnova |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
FC, IF, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
RUNX2 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Konjugation: |
PE |
| PE conjugated mouse monoclonal antibody raised against a partial recombinant RUNX2. |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[1D8] |
| Isotyp: |
IgG2b |
| UniProt: |
860 |
| Puffer: |
In 1x PBS, pH 7.4 |
| Formulierung: |
Liquid |
| Sequenz: |
NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA |
| Target-Kategorie: |
RUNX2 |
