CKS2 monoclonal antibody (M01), clone 2H5-2C4, Clone: [2H5-2C4], Mouse, Monoclonal

Artikelnummer: ABN-H00001164-M01
Artikelname: CKS2 monoclonal antibody (M01), clone 2H5-2C4, Clone: [2H5-2C4], Mouse, Monoclonal
Artikelnummer: ABN-H00001164-M01
Hersteller Artikelnummer: H00001164-M01
Alternativnummer: ABN-H00001164-M01-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: CKS2 (AAH06458, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full length recombinant CKS2.
Klonalität: Monoclonal
Klon-Bezeichnung: [2H5-2C4]
UniProt: 1164
Puffer: In 1x PBS, pH 7.4
Sequenz: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Target-Kategorie: CKS2