CKS2 monoclonal antibody (M02), clone 2G12-2A5, Clone: [2G12-2A5], Mouse, Monoclonal

Artikelnummer: ABN-H00001164-M02
Artikelname: CKS2 monoclonal antibody (M02), clone 2G12-2A5, Clone: [2G12-2A5], Mouse, Monoclonal
Artikelnummer: ABN-H00001164-M02
Hersteller Artikelnummer: H00001164-M02
Alternativnummer: ABN-H00001164-M02-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: CKS2 (AAH06458, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full length recombinant CKS2.
Klonalität: Monoclonal
Klon-Bezeichnung: [2G12-2A5]
UniProt: 1164
Puffer: In 1x PBS, pH 7.4
Sequenz: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Target-Kategorie: CKS2