CORT monoclonal antibody (M01), clone 8G10, Clone: [8G10], Mouse, Monoclonal

Artikelnummer: ABN-H00001325-M01
Artikelname: CORT monoclonal antibody (M01), clone 8G10, Clone: [8G10], Mouse, Monoclonal
Artikelnummer: ABN-H00001325-M01
Hersteller Artikelnummer: H00001325-M01
Alternativnummer: ABN-H00001325-M01-100
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: CORT (NP_001293.2, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full-length recombinant CORT.
Klonalität: Monoclonal
Klon-Bezeichnung: [8G10]
UniProt: 1325
Puffer: In 1x PBS, pH 7.4
Sequenz: MYRHKNSWRLGLKYPPSSKEETQVPKTLISGLPGRKSSSRVGEKLQSAHKMPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Target-Kategorie: CORT