CRX monoclonal antibody (MP02), clone 4G11 (PE), Clone: [4G11], Mouse, Monoclonal
Artikelnummer:
ABN-H00001406-MP02
| Artikelname: |
CRX monoclonal antibody (MP02), clone 4G11 (PE), Clone: [4G11], Mouse, Monoclonal |
| Artikelnummer: |
ABN-H00001406-MP02 |
| Hersteller Artikelnummer: |
H00001406-MP02 |
| Alternativnummer: |
ABN-H00001406-MP02-50,ABN-H00001406-MP02-3 |
| Hersteller: |
Abnova |
| Wirt: |
Mouse |
| Kategorie: |
Antikörper |
| Applikation: |
FC, IF, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
CRX (NP_000545, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Konjugation: |
PE |
| PE conjugated mouse monoclonal antibody raised against a partial recombinant CRX. |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[4G11] |
| UniProt: |
1406 |
| Puffer: |
In 1x PBS, pH 7.4 |
| Formulierung: |
Liquid |
| Sequenz: |
MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR |
| Target-Kategorie: |
CRX |