CRYAB monoclonal antibody (M01A), clone S4, Mouse, Monoclonal

Artikelnummer: ABN-H00001410-M01A
Artikelname: CRYAB monoclonal antibody (M01A), clone S4, Mouse, Monoclonal
Artikelnummer: ABN-H00001410-M01A
Hersteller Artikelnummer: H00001410-M01A
Alternativnummer: ABN-H00001410-M01A-200
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: CRYAB (AAH07008.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against a full-length recombinant CRYAB.
Klonalität: Monoclonal
UniProt: 1410
Puffer: In ascites fluid
Sequenz: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK
Target-Kategorie: CRYAB