CSTA monoclonal antibody (MP01), clone 1A11 (PE), Clone: [1A11], Mouse, Monoclonal

Artikelnummer: ABN-H00001475-MP01
Artikelname: CSTA monoclonal antibody (MP01), clone 1A11 (PE), Clone: [1A11], Mouse, Monoclonal
Artikelnummer: ABN-H00001475-MP01
Hersteller Artikelnummer: H00001475-MP01
Alternativnummer: ABN-H00001475-MP01-50,ABN-H00001475-MP01-3
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: FC, IF, WB
Spezies Reaktivität: Human
Immunogen: CSTA (AAH10379, 1 a.a. ~ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Konjugation: PE
PE conjugated mouse monoclonal antibody raised against a full-length recombinant CSTA.
Klonalität: Monoclonal
Klon-Bezeichnung: [1A11]
UniProt: 1475
Puffer: In 1x PBS, pH 7.4
Formulierung: Liquid
Sequenz: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Target-Kategorie: CSTA