ZEB1 monoclonal antibody, clone CL0151, IgG1, Clone: [CL0151], Mouse, Monoclonal

Artikelnummer: ABN-MAB15542
Artikelname: ZEB1 monoclonal antibody, clone CL0151, IgG1, Clone: [CL0151], Mouse, Monoclonal
Artikelnummer: ABN-MAB15542
Hersteller Artikelnummer: MAB15542
Alternativnummer: ABN-MAB15542-100,ABN-MAB15542-25
Hersteller: Abnova
Wirt: Mouse
Kategorie: Antikörper
Applikation: IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein corresponding to human ZEB1.
Alternative Synonym: ABN-202409-10_Ab
Mouse monoclonal antibody raised against partial recombinant human ZEB1.
Klonalität: Monoclonal
Klon-Bezeichnung: [CL0151]
Isotyp: IgG1
UniProt: 6935
Puffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Formulierung: Liquid
Sequenz: EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Target-Kategorie: ZEB1
Application Verdünnung: Immunofluorescence (1-4 ug/mL)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)Western Blot (1:500-1:1000)The optimal working dilution should be determined by the end user.