VP1 (Adeno-associated virus ) Recombinant Protein, E. coli
Artikelnummer:
ABN-P10551
| Artikelname: |
VP1 (Adeno-associated virus ) Recombinant Protein, E. coli |
| Artikelnummer: |
ABN-P10551 |
| Hersteller Artikelnummer: |
P10551 |
| Alternativnummer: |
ABN-P10551-100 |
| Hersteller: |
Abnova |
| Wirt: |
E. coli |
| Kategorie: |
Proteine/Peptide |
| Applikation: |
SDS-PAGE |
| Spezies Reaktivität: |
Virus |
| Adeno-associated virus VP1 full-length recombinant protein with His tag expressed in Adeno-associated virus |
| Tag: |
His (N-term) |
| UniProt: |
1489598 |
| Puffer: |
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4. |
| Reinheit: |
>=90% as determined by SDS-PAGE. |
| Formulierung: |
Lyophilized |
| Sequenz: |
MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLDSGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRVLEPLGLVEEPVKTAPGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLNFGQTGDADSVPDPQPLGQPPAAPSGLGTNTMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNH |
| Target-Kategorie: |
vp |
| Application Verdünnung: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
