Alb (Mouse) Recombinant Protein, Human

Artikelnummer: ABN-P10560
Artikelname: Alb (Mouse) Recombinant Protein, Human
Artikelnummer: ABN-P10560
Hersteller Artikelnummer: P10560
Alternativnummer: ABN-P10560-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Alb full-length recombinant protein with His tag at the C-terminus expressed in HEK293 cells.
Tag: His (C-term)
UniProt: 11657
Puffer: Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Reinheit: >=95% as determined by SDS-PAGE.
Formulierung: Lyophilized
Sequenz: MKWVTFLLLLFVSGSAFSRGVFRREAHKSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESAANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEPERNECFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAEI
Target-Kategorie: Alb
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.