CTLA4 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P10572
Artikelname: CTLA4 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P10572
Hersteller Artikelnummer: P10572
Alternativnummer: ABN-P10572-100
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human CTLA4 partial recombinant protein with His tag expressed in CHO cells.
Tag: His (C-term)
UniProt: 1493
Puffer: Lyophilized from filtered PBS, pH 7.4.
Reinheit: >=95% by SDS-PAGE
Formulierung: Lyophilized
Sequenz: MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Target-Kategorie: CTLA4
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.