IL10 (Human) Recombinant Protein

Artikelnummer: ABN-P10580
Artikelname: IL10 (Human) Recombinant Protein
Artikelnummer: ABN-P10580
Hersteller Artikelnummer: P10580
Alternativnummer: ABN-P10580-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human IL10 partial recombinant protein with His tag expressed in HEK293 cells.
Tag: His (N-term)
UniProt: 3586
Puffer: Lyophilized from filtered PBS, pH 7.4.
Formulierung: Lyophilized
Sequenz: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Target-Kategorie: IL10
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.