IL1B (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P10595
Artikelname: IL1B (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P10595
Hersteller Artikelnummer: P10595
Alternativnummer: ABN-P10595-100
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human IL1B partial recombinant protein with His tag expressed in CHO cells.
Tag: His (N-term)
UniProt: 3553
Puffer: Lyophilized from filtered PBS, pH 7.4.
Reinheit: >=95% by SDS-PAGE
Formulierung: Lyophilized
Sequenz: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Target-Kategorie: IL1B
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.