Cd276 (Mouse) Recombinant Protein, Human

Artikelnummer: ABN-P10608
Artikelname: Cd276 (Mouse) Recombinant Protein, Human
Artikelnummer: ABN-P10608
Hersteller Artikelnummer: P10608
Alternativnummer: ABN-P10608-100
Hersteller: Abnova
Wirt: Human
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Cd276 partial recombinant protein with His tag expressed in HEK293 cells.
Tag: His (C-term)
UniProt: 102657
Puffer: Lyophilized from filtered PBS, pH 7.4.
Reinheit: >=90% by SDS-PAGE
Formulierung: Lyophilized
Sequenz: VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTF
Target-Kategorie: Cd276
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.