Ly6g (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P10613
Artikelname: Ly6g (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P10613
Hersteller Artikelnummer: P10613
Alternativnummer: ABN-P10613-100
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Ly6g partial recombinant protein with His tag expressed in CHO cells.
Tag: His (N-term)
UniProt: 546644
Puffer: Lyophilized from filtered PBS, pH 7.4.
Reinheit: >=95% by SDS-PAGE
Formulierung: Lyophilized
Sequenz: LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Target-Kategorie: Ly6g
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.