Il15 (Mouse) Recombinant Protein, Mammal
Artikelnummer:
ABN-P10625
| Artikelname: |
Il15 (Mouse) Recombinant Protein, Mammal |
| Artikelnummer: |
ABN-P10625 |
| Hersteller Artikelnummer: |
P10625 |
| Alternativnummer: |
ABN-P10625-100 |
| Hersteller: |
Abnova |
| Wirt: |
Mammal |
| Kategorie: |
Proteine/Peptide |
| Applikation: |
SDS-PAGE |
| Spezies Reaktivität: |
Mouse |
| Mouse Il15 partial recombinant protein with Human IgG1 Fc tag at the C-terminus expressed in CHO cells. |
| Tag: |
Fc (C-term) |
| UniProt: |
16168 |
| Puffer: |
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4. |
| Reinheit: |
>=95% as determined by SDS-PAGE. |
| Formulierung: |
Lyophilized |
| Sequenz: |
VSVGLPKTEANWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS |
| Target-Kategorie: |
Il15 |
| Application Verdünnung: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |
