GCG (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P10633
Artikelname: GCG (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P10633
Hersteller Artikelnummer: P10633
Alternativnummer: ABN-P10633-100
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human GCG partial recombinant protein with His tag at the C-terminus expressed in CHO cells.
Tag: His (C-term)
UniProt: 2641
Puffer: Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Reinheit: >=90% as determined by SDS-PAGE.
Formulierung: Lyophilized
Sequenz: RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Target-Kategorie: GCG
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.