Fcgr3 (Mouse) Recombinant Protein, Mammal

Artikelnummer: ABN-P10637
Artikelname: Fcgr3 (Mouse) Recombinant Protein, Mammal
Artikelnummer: ABN-P10637
Hersteller Artikelnummer: P10637
Alternativnummer: ABN-P10637-100
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Fcgr3 partial recombinant protein with His tag at the C-terminus expressed in CHO cells.
Tag: His (C-term)
UniProt: 14131
Puffer: Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Reinheit: >=95% as determined by SDS-PAGE.
Formulierung: Lyophilized
Sequenz: LPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSVRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
Target-Kategorie: Fcgr3
Application Verdünnung: SDS-PAGEThe optimal working dilution should be determined by the end user.