CD40 (Human) Recombinant Protein, Mammal
Artikelnummer:
ABN-P10642
| Artikelname: |
CD40 (Human) Recombinant Protein, Mammal |
| Artikelnummer: |
ABN-P10642 |
| Hersteller Artikelnummer: |
P10642 |
| Alternativnummer: |
ABN-P10642-100 |
| Hersteller: |
Abnova |
| Wirt: |
Mammal |
| Kategorie: |
Proteine/Peptide |
| Applikation: |
SDS-PAGE |
| Spezies Reaktivität: |
Human |
| Human CD40 partial recombinant protein with His tag at the C-terminus expressed in CHO cells. |
| Tag: |
His (C-term) |
| UniProt: |
958 |
| Puffer: |
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4. |
| Reinheit: |
>=90% as determined by SDS-PAGE. |
| Formulierung: |
Lyophilized |
| Sequenz: |
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Target-Kategorie: |
CD40 |
| Application Verdünnung: |
SDS-PAGEThe optimal working dilution should be determined by the end user. |