Anti-Ataxin-1, 11NQ Antibody FL594 Conjugate, IgG2b, Clone: [N76/8], Mouse, Monoclonal

Artikelnummer: ANI-75-117-FL594
Artikelname: Anti-Ataxin-1, 11NQ Antibody FL594 Conjugate, IgG2b, Clone: [N76/8], Mouse, Monoclonal
Artikelnummer: ANI-75-117-FL594
Hersteller Artikelnummer: 75-117-FL594
Alternativnummer: ANI-75-117-FL594
Hersteller: Antibodies Incorporated
Wirt: Mouse
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
Konjugation: FL594
Alternative Synonym: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)
Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Klonalität: Monoclonal
Konzentration: 0.5 mg/mL
Klon-Bezeichnung: [N76/8]
Molekulargewicht: 85 kDa
Isotyp: IgG2b
UniProt: P54254
Puffer: PBS with 0.09% azide
Target-Kategorie: Ataxin-1, 11NQ
Antibody Type: Primary Antibody
Anwendungsbeschreibung: Format: Purified by Protein A chromatography