SPATA5 Antibody : HRP (ARP52814_P050-HRP), Rabbit, Polyclonal

Artikelnummer: ASB-ARP52814_P050-HRP
Artikelname: SPATA5 Antibody : HRP (ARP52814_P050-HRP), Rabbit, Polyclonal
Artikelnummer: ASB-ARP52814_P050-HRP
Hersteller Artikelnummer: ARP52814_P050-HRP
Alternativnummer: ASB-ARP52814_P050-HRP-100UL
Hersteller: Aviva
Wirt: Rabbit
Kategorie: Antikörper
Spezies Reaktivität: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence EIIELPLKQPELFKSYGIPAPRGVLLYGPPGTGKTMIARAVANEVGAYVS
Konjugation: HRP
Alternative Synonym: AFG2, SPAF, EHLMRS
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 98 kDa
NCBI: 166378
UniProt: Q8NB90
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.