LGALS7 Antibody
Artikelnummer:
ASB-ARP64142_P050
- Bilder (3)
| Artikelname: | LGALS7 Antibody |
| Artikelnummer: | ASB-ARP64142_P050 |
| Hersteller Artikelnummer: | ARP64142_P050 |
| Alternativnummer: | ASB-ARP64142_P050-25UL,ASB-ARP64142_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP |
| Alternative Synonym: | GAL7, LGALS7A |
| The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. |
|
|
Rabbit Anti-LGALS7 antibody Catalog Number: ARP64142 Formalin Fixed Paraffin Embedded Tissue: Human Skin Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-LGALS7 antibody Catalog Number: ARP64142 Formalin Fixed Paraffin Embedded Tissue: Human Thymus Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
LGALS7 Antibody (ARP64142_P050) in Human Skin using Immunohistochemistry |
Produktgarantie und fachkundiger Support
