Omp Pylori Protein, E. coli

Artikelnummer: ASB-OPPA02479
Artikelname: Omp Pylori Protein, E. coli
Artikelnummer: ASB-OPPA02479
Hersteller Artikelnummer: OPPA02479
Alternativnummer: ASB-OPPA02479-100UG
Hersteller: Aviva
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: ELISA, LF
Spezies Reaktivität: H. pylori
Alternative Synonym: Omp Pylori
Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the worlds population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection.
Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Konzentration: 1.55 mg/ml
Molekulargewicht: 23 kDa
Reinheit: Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Formulierung: Liquid 1xPBS (pH 7.4)
Sequenz: MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.