Anti-RCC1

Artikelnummer: ATA-HPA027574
Artikelname: Anti-RCC1
Artikelnummer: ATA-HPA027574
Hersteller Artikelnummer: HPA027574
Alternativnummer: ATA-HPA027574-100,ATA-HPA027574-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CHC1
regulator of chromosome condensation 1
Anti-RCC1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1104
UniProt: P18754
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RCC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear membrane.
Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
Western blot analysis using Anti-RCC1 antibody HPA027574 (A) shows similar pattern to independent antibody HPA027573 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA027574-100ul
HPA027574-100ul
HPA027574-100ul