Anti-ENPP3
Artikelnummer:
ATA-HPA043772
- Bilder (9)
| Artikelname: | Anti-ENPP3 |
| Artikelnummer: | ATA-HPA043772 |
| Hersteller Artikelnummer: | HPA043772 |
| Alternativnummer: | ATA-HPA043772-100,ATA-HPA043772-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | B10, CD203c, gp130RB13-6, PD-IBETA, PDNP3 |
| ectonucleotide pyrophosphatase/phosphodiesterase 3 |
| Anti-ENPP3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5169 |
| UniProt: | O14638 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ENPP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human small intestine and placenta tissues using HPA043772 antibody. Corresponding ENPP3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human small intestine shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human duodenum shows weak membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human endometrium shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells. |
|
|
HPA043772-100ul |
|
|
HPA043772-100ul |
|
|
HPA043772-100ul |
Produktgarantie und fachkundiger Support
