Recombinant E. coli K99 fimbrial protein (fanC), Unconjugated

Artikelnummer: BIM-RPC20556
Artikelname: Recombinant E. coli K99 fimbrial protein (fanC), Unconjugated
Artikelnummer: BIM-RPC20556
Hersteller Artikelnummer: RPC20556
Alternativnummer: BIM-RPC20556-20UG,BIM-RPC20556-100UG,BIM-RPC20556-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: fanCK99 fimbrial protein
Recombinant E. coli K99 fimbrial protein (fanC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: fanC. Target Synonyms: fanCK99 fimbrial protein. Accession Number: P18103. Expression Region: 23~181aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Target-Kategorie: fanC