Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20565
Artikelname: Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20565
Hersteller Artikelnummer: RPC20565
Alternativnummer: BIM-RPC20565-20UG,BIM-RPC20565-100UG,BIM-RPC20565-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Clinically amyopathic dermatomyositis autoantigen 140 kDaCADM-140 autoantigenHelicase with 2 CARD domainsHelicardInterferon-induced with helicase C domain protein 1Melanoma differentiation-associated protein 5MDA-5Murabutide down-regulated proteinRIG-I-like receptor 2RLR-2RNA helicase-DEAD box protein 116
Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IFIH1. Target Synonyms: Clinically amyopathic dermatomyositis autoantigen 140 kDaCADM-140 autoantigenHelicase with 2 CARD domainsHelicardInterferon-induced with helicase C domain protein 1. Accession Number: Q9BYX4. Expression Region: 700~1025aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 53.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: KLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADY
Target-Kategorie: IFIH1