Recombinant Human Thymic stromal lymphopoietin (TSLP), Unconjugated, Mammal

Artikelnummer: BIM-RPC20590
Artikelname: Recombinant Human Thymic stromal lymphopoietin (TSLP), Unconjugated, Mammal
Artikelnummer: BIM-RPC20590
Hersteller Artikelnummer: RPC20590
Alternativnummer: BIM-RPC20590-20UG,BIM-RPC20590-100UG,BIM-RPC20590-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Thymic stromal lymphopoietin, Thymic stromal lymphopoietin protein TSLP, Tslp, TSLP protein, TSLP_HUMAN
Recombinant Human Thymic stromal lymphopoietin (TSLP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TSLP. Target Synonyms: Thymic stromal lymphopoietin, Thymic stromal lymphopoietin protein TSLP, Tslp, TSLP protein, TSLP_HUMAN. Accession Number: Q969D9. Expression Region: 29~159aa. Tag Info: N-Terminal 6Xhis-Myc-Tagged. Theoretical MW: 18.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.9kDa
Tag: N-Terminal 6Xhis-Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Target-Kategorie: TSLP