Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1), Unconjugated, Mammal

Artikelnummer: BIM-RPC20602
Artikelname: Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1), Unconjugated, Mammal
Artikelnummer: BIM-RPC20602
Hersteller Artikelnummer: RPC20602
Alternativnummer: BIM-RPC20602-20UG,BIM-RPC20602-100UG,BIM-RPC20602-1MG
Hersteller: Biomatik Corporation
Wirt: Mammal
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rabbit
Konjugation: Unconjugated
Alternative Synonym: Adenosine 5-monophosphoramidaseP13.7
Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus). Target Name: HINT1. Target Synonyms: Adenosine 5-monophosphoramidaseP13.7. Accession Number: P80912. Expression Region: 2~126aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 17.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
Target-Kategorie: HINT1