Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt), Unconjugated, Virus

Artikelnummer: BIM-RPC20615
Artikelname: Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt), Unconjugated, Virus
Artikelnummer: BIM-RPC20615
Hersteller Artikelnummer: RPC20615
Alternativnummer: BIM-RPC20615-20UG,BIM-RPC20615-100UG,BIM-RPC20615-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: apt, SPy_0927, M5005_Spy0728Adenine phosphoribosyltransferase, APRT, EC 2.4.2.7
Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Streptococcus pyogenes serotype M1. Target Name: apt. Target Synonyms: apt, SPy_0927, M5005_Spy0728Adenine phosphoribosyltransferase, APRT, EC 2.4.2.7. Accession Number: P63546. Expression Region: 1~172aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 22.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
Target-Kategorie: apt