Recombinant Human Cathepsin O (CTSO), Unconjugated, Virus

Artikelnummer: BIM-RPC20625
Artikelname: Recombinant Human Cathepsin O (CTSO), Unconjugated, Virus
Artikelnummer: BIM-RPC20625
Hersteller Artikelnummer: RPC20625
Alternativnummer: BIM-RPC20625-20UG,BIM-RPC20625-100UG,BIM-RPC20625-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: CTSO1
Recombinant Human Cathepsin O (CTSO) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CTSO. Target Synonyms: CTSO1. Accession Number: P43234. Expression Region: 108~321aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged. Theoretical MW: 67.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 67.5kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV
Target-Kategorie: CTSO