Recombinant Macaca mulatta Interleukin-10 (IL10), Unconjugated, Virus

Artikelnummer: BIM-RPC20636
Artikelname: Recombinant Macaca mulatta Interleukin-10 (IL10), Unconjugated, Virus
Artikelnummer: BIM-RPC20636
Hersteller Artikelnummer: RPC20636
Alternativnummer: BIM-RPC20636-20UG,BIM-RPC20636-100UG,BIM-RPC20636-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Monkey
Konjugation: Unconjugated
Alternative Synonym: Cytokine synthesis inhibitory factor
Recombinant Macaca mulatta Interleukin-10 (IL10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Macaca mulatta (Rhesus macaque). Target Name: IL10. Target Synonyms: Cytokine synthesis inhibitory factor. Accession Number: P51496. Expression Region: 19~178aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 22.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Target-Kategorie: IL10