Recombinant Human 7, 8-dihydro-8-oxoguanine triphosphatase (NUDT1), Unconjugated, Virus

Artikelnummer: BIM-RPC20646
Artikelname: Recombinant Human 7, 8-dihydro-8-oxoguanine triphosphatase (NUDT1), Unconjugated, Virus
Artikelnummer: BIM-RPC20646
Hersteller Artikelnummer: RPC20646
Alternativnummer: BIM-RPC20646-20UG,BIM-RPC20646-100UG,BIM-RPC20646-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 2-hydroxy-dATP diphosphatase (EC:3.6.1.56)8-oxo-dGTPaseNucleoside diphosphate-linked moiety X motif 1
Recombinant Human 7, 8-dihydro-8-oxoguanine triphosphatase (NUDT1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: NUDT1. Target Synonyms: 2-hydroxy-dATP diphosphatase (EC:3.6.1.56)8-oxo-dGTPaseNucleoside diphosphate-linked moiety X motif 1. Accession Number: P36639. Expression Region: 19~197aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 22.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.8kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Target-Kategorie: NUDT1