Recombinant Human ATP-dependent DNA helicase Q1 (RECQL), Unconjugated, Virus

Artikelnummer: BIM-RPC20652
Artikelname: Recombinant Human ATP-dependent DNA helicase Q1 (RECQL), Unconjugated, Virus
Artikelnummer: BIM-RPC20652
Hersteller Artikelnummer: RPC20652
Alternativnummer: BIM-RPC20652-20UG,BIM-RPC20652-100UG,BIM-RPC20652-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: DNA helicase, RecQ-like type 1RecQ1DNA-dependent ATPase Q1RecQ protein-like 1RECQ1, RECQL1
Recombinant Human ATP-dependent DNA helicase Q1 (RECQL) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RECQL. Target Synonyms: DNA helicase, RecQ-like type 1RecQ1DNA-dependent ATPase Q1RecQ protein-like 1RECQ1, RECQL1. Accession Number: P46063. Expression Region: 1~649aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 76kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 76kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MASVSALTEELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTA
Target-Kategorie: RECQL