Recombinant Human Pulmonary surfactant-associated protein B (SFTPB), Unconjugated, Virus

Artikelnummer: BIM-RPC20656
Artikelname: Recombinant Human Pulmonary surfactant-associated protein B (SFTPB), Unconjugated, Virus
Artikelnummer: BIM-RPC20656
Hersteller Artikelnummer: RPC20656
Alternativnummer: BIM-RPC20656-20UG,BIM-RPC20656-100UG,BIM-RPC20656-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: 18 kDa pulmonary-surfactant protein6 kDa proteinPulmonary surfactant-associated proteolipid SPL(Phe)
Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SFTPB. Target Synonyms: 18 kDa pulmonary-surfactant protein6 kDa proteinPulmonary surfactant-associated proteolipid SPL(Phe). Accession Number: P07988. Expression Region: 201~279aa. Tag Info: N-Terminal Mbp-Tagged. Theoretical MW: 50.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 50.7kDa
Tag: N-Terminal Mbp-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Target-Kategorie: SFTPB