Recombinant Human Mothers against decapentaplegic homolog 3 (SMAD3), Unconjugated, Virus

Artikelnummer: BIM-RPC20657
Artikelname: Recombinant Human Mothers against decapentaplegic homolog 3 (SMAD3), Unconjugated, Virus
Artikelnummer: BIM-RPC20657
Hersteller Artikelnummer: RPC20657
Alternativnummer: BIM-RPC20657-20UG,BIM-RPC20657-100UG,BIM-RPC20657-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: JV15-2SMAD family member 3, SMAD 3, Smad3, hSMAD3
Recombinant Human Mothers against decapentaplegic homolog 3 (SMAD3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SMAD3. Target Synonyms: JV15-2SMAD family member 3, SMAD 3, Smad3, hSMAD3. Accession Number: P84022. Expression Region: 1~425aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 50.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 50.6kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSM
Target-Kategorie: SMAD3