Recombinant Nostoc sp. Alr2278 protein (alr2278), Unconjugated, Virus

Artikelnummer: BIM-RPC20664
Artikelname: Recombinant Nostoc sp. Alr2278 protein (alr2278), Unconjugated, Virus
Artikelnummer: BIM-RPC20664
Hersteller Artikelnummer: RPC20664
Alternativnummer: BIM-RPC20664-20UG,BIM-RPC20664-100UG,BIM-RPC20664-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Recombinant Nostoc sp. Alr2278 protein (alr2278) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). Target Name: alr2278. Accession Number: Q8YUQ7. Expression Region: 1~189aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged. Theoretical MW: 65.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 65.2kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD
Target-Kategorie: alr2278