Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin (ply), Unconjugated, Virus

Artikelnummer: BIM-RPC20669
Artikelname: Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin (ply), Unconjugated, Virus
Artikelnummer: BIM-RPC20669
Hersteller Artikelnummer: RPC20669
Alternativnummer: BIM-RPC20669-20UG,BIM-RPC20669-100UG,BIM-RPC20669-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Thiol-activated cytolysin
Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin (ply) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4). Target Name: ply. Target Synonyms: Thiol-activated cytolysin. Accession Number: P0C2J9. Expression Region: 2~471aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 56.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 56.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKS
Target-Kategorie: ply