Recombinant Mycobacterium bovis Alpha-crystallin (hspX), Unconjugated, Virus

Artikelnummer: BIM-RPC20675
Artikelname: Recombinant Mycobacterium bovis Alpha-crystallin (hspX), Unconjugated, Virus
Artikelnummer: BIM-RPC20675
Hersteller Artikelnummer: RPC20675
Alternativnummer: BIM-RPC20675-20UG,BIM-RPC20675-100UG,BIM-RPC20675-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: 16 kDa antigenHSP 16.3
Recombinant Mycobacterium bovis Alpha-crystallin (hspX) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97). Target Name: hspX. Target Synonyms: 16 kDa antigenHSP 16.3. Accession Number: P0A5B8. Expression Region: 2~144aa. Tag Info: C-Terminal 9Xhis-Tagged. Theoretical MW: 18.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.1kDa
Tag: C-Terminal 9Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Target-Kategorie: hspX