Recombinant Bovine Odorant-binding protein, Unconjugated, Virus

Artikelnummer: BIM-RPC20680
Artikelname: Recombinant Bovine Odorant-binding protein, Unconjugated, Virus
Artikelnummer: BIM-RPC20680
Hersteller Artikelnummer: RPC20680
Alternativnummer: BIM-RPC20680-20UG,BIM-RPC20680-100UG,BIM-RPC20680-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: Olfactory mucosa pyrazine-binding protein
Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: Bovine Odorant-binding protein. Target Synonyms: Olfactory mucosa pyrazine-binding protein. Accession Number: P07435. Expression Region: 1~159aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.0kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Target-Kategorie: Bovine Odorant-binding protein