Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 12 (Adam12), partial, Unconjugated, Virus

Artikelnummer: BIM-RPC20690
Artikelname: Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 12 (Adam12), partial, Unconjugated, Virus
Artikelnummer: BIM-RPC20690
Hersteller Artikelnummer: RPC20690
Alternativnummer: BIM-RPC20690-20UG,BIM-RPC20690-100UG,BIM-RPC20690-1MG
Hersteller: Biomatik Corporation
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Meltrin-alpha
Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 12 (Adam12), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Adam12. Target Synonyms: Meltrin-alpha. Accession Number: Q61824. Expression Region: 206~706aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 58.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 58.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDA
Target-Kategorie: Adam12