Recombinant Pig Translocator protein (TSPO), Unconjugated

Artikelnummer: BIM-RPC20809
Artikelname: Recombinant Pig Translocator protein (TSPO), Unconjugated
Artikelnummer: BIM-RPC20809
Hersteller Artikelnummer: RPC20809
Alternativnummer: BIM-RPC20809-20UG,BIM-RPC20809-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Porcine
Konjugation: Unconjugated
Alternative Synonym: Peripheral-type benzodiazepine receptor
Recombinant Pig Translocator protein (TSPO) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: TSPO. Target Synonyms: Peripheral-type benzodiazepine receptor. Accession Number: Q6UN27. Expression Region: 1~169aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 38.6kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE
Target-Kategorie: TSPO