Recombinant Human F-box/WD repeat-containing protein 7 (FBXW7), Unconjugated

Artikelnummer: BIM-RPC20817
Artikelname: Recombinant Human F-box/WD repeat-containing protein 7 (FBXW7), Unconjugated
Artikelnummer: BIM-RPC20817
Hersteller Artikelnummer: RPC20817
Alternativnummer: BIM-RPC20817-20UG,BIM-RPC20817-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Archipelago homolog1 PublicationhAgo1 PublicationF-box and WD-40 domain-containing protein 7CuratedF-box protein FBX301 PublicationSEL-101 PublicationhCdc4
Recombinant Human F-box/WD repeat-containing protein 7 (FBXW7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FBXW7. Target Synonyms: Archipelago homolog1 PublicationhAgo1 PublicationF-box and WD-40 domain-containing protein 7CuratedF-box protein FBX301 PublicationSEL-101 PublicationhCdc4. Accession Number: Q969H0. Expression Region: 1~707aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 83.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 83.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDE
Target-Kategorie: FBXW7